Danish
Uniprot ID:  Q8TLY9
  • Protein: Globin-sensor domain-containing protein
  • Organism: Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
  • Length: 195
  • Sequence:
    • MSVEKIPGYTYGETENRAPFNLEDLKLLKEAVMFTAEDEEYIQKAGEVLEDQVEEILDTWYGFVGSHPHLLYYFTSPDGTPNEKYLAAVRKRFSRWILDTCNRSYDQAWLDYQYEIGLRHHRTKKNQTDNVESVPNIGYRYLVAFIYPITATMKPFLARKGHTPEEVEKMYQAWFKATTLQVALWSYPYVKYGDF
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  52
PDB ID:  pdb_00002veb , Chain A 
Resolution 1.30 Å
Residue indices (Uniprot), coverage 6-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9949
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00002veb , Chain A-1 
Resolution 1.30 Å
Residue indices (Uniprot), coverage 6-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9949
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00003qzx , Chain A 
Resolution 1.30 Å
Residue indices (Uniprot), coverage 6-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Y61A, C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9897
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00003qzx , Chain A-1 
Resolution 1.30 Å
Residue indices (Uniprot), coverage 6-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Y61A, C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9897
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00003zjp , Chain A 
Resolution 1.38 Å
Residue indices (Uniprot), coverage 5-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9949
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00003zjp , Chain A-1 
Resolution 1.38 Å
Residue indices (Uniprot), coverage 5-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9949
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00003zji , Chain A 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 4-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Y61A, C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9897
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003zji , Chain B 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 5-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Y61A, C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9897
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00003zjl , Chain A 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 5-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S, L142A
Insertions None
Deletions None
Sequence identity to UniProt 0.9897
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003zjl , Chain B 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 5-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S, L142A
Insertions None
Deletions None
Sequence identity to UniProt 0.9897
auth_asym_id B
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003zjm , Chain A 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 5-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S, I149F
Insertions None
Deletions None
Sequence identity to UniProt 0.9897
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00003zjm , Chain B 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 5-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S, I149F
Insertions None
Deletions None
Sequence identity to UniProt 0.9897
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00003zjm , Chain C 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 5-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S, I149F
Insertions None
Deletions None
Sequence identity to UniProt 0.9897
auth_asym_id C
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00003zjm , Chain C-1 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 5-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S, I149F
Insertions None
Deletions None
Sequence identity to UniProt 0.9897
auth_asym_id C
label_asym_ids of heme J-1
Available structure PDB
PDB ID:  pdb_00003zjn , Chain A 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 6-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9949
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003zjn , Chain B 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 5-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9949
auth_asym_id B
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00003zol , Chain A 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 5-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) F93Y, C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9897
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003zol , Chain B 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 5-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) F93Y, C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9897
auth_asym_id B
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003zjh , Chain A 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 5-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) W60A, C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9897
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003zjh , Chain B 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 3-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) W60A, C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9897
auth_asym_id B
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003zjo , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 6-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9949
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003zjo , Chain B 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 6-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9949
auth_asym_id B
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003zjq , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 6-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9949
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003zjq , Chain B 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 5-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9949
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00003zh0 , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 20-195 (21-195), 0.90
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) C101S
Insertions None
Deletions S2-F20
Sequence identity to UniProt 0.9943
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003zh0 , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 20-195 (21-195), 0.90
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) C101S
Insertions None
Deletions S2-F20
Sequence identity to UniProt 0.9943
auth_asym_id B
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00003zh0 , Chain C 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 20-195 (21-195), 0.90
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) C101S
Insertions None
Deletions S2-F20
Sequence identity to UniProt 0.9943
auth_asym_id C
label_asym_ids of heme L
Available structure PDB
PDB ID:  pdb_00003zh0 , Chain D 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 20-195 (21-195), 0.90
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) C101S
Insertions None
Deletions S2-F20
Sequence identity to UniProt 0.9943
auth_asym_id D
label_asym_ids of heme R
Available structure PDB
PDB ID:  pdb_00003zjj , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 6-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) F93L, C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9897
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00003zjj , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 6-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) F93L, C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9897
auth_asym_id B
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00003zjj , Chain C 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 6-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) F93L, C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9897
auth_asym_id C
label_asym_ids of heme N
Available structure PDB
PDB ID:  pdb_00003zjj , Chain C-1 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 6-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) F93L, C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9897
auth_asym_id C
label_asym_ids of heme N-1
Available structure PDB
PDB ID:  pdb_00003r0g , Chain A 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 5-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S, I149F
Insertions None
Deletions None
Sequence identity to UniProt 0.9897
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003r0g , Chain B 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 5-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S, I149F
Insertions None
Deletions None
Sequence identity to UniProt 0.9897
auth_asym_id B
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00003zom , Chain A 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 5-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S, F145W
Insertions None
Deletions None
Sequence identity to UniProt 0.9897
auth_asym_id A
label_asym_ids of heme C ,  C
Available structure PDB
PDB ID:  pdb_00003zom , Chain A 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 5-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S, F145W
Insertions None
Deletions None
Sequence identity to UniProt 0.9897
auth_asym_id A
label_asym_ids of heme C ,  C
Available structure PDB
PDB ID:  pdb_00003zom , Chain B 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 5-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S, F145W
Insertions None
Deletions None
Sequence identity to UniProt 0.9897
auth_asym_id B
label_asym_ids of heme E ,  E
Available structure PDB
PDB ID:  pdb_00003zom , Chain B 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 5-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S, F145W
Insertions None
Deletions None
Sequence identity to UniProt 0.9897
auth_asym_id B
label_asym_ids of heme E ,  E
Available structure PDB
PDB ID:  pdb_00003zjs , Chain A 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 5-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9949
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003zjs , Chain B 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 5-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9949
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00003qzz , Chain A 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 6-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Y61W, C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9897
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00003qzz , Chain A-1 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 6-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Y61W, C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9897
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00002vee , Chain A 
Resolution 2.60 Å
Residue indices (Uniprot), coverage 6-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9949
auth_asym_id A
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00002vee , Chain B 
Resolution 2.60 Å
Residue indices (Uniprot), coverage 6-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9949
auth_asym_id B
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00002vee , Chain C 
Resolution 2.60 Å
Residue indices (Uniprot), coverage 6-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9949
auth_asym_id C
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00002vee , Chain D 
Resolution 2.60 Å
Residue indices (Uniprot), coverage 6-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9949
auth_asym_id D
label_asym_ids of heme L
Available structure PDB
PDB ID:  pdb_00002vee , Chain E 
Resolution 2.60 Å
Residue indices (Uniprot), coverage 6-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9949
auth_asym_id E
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00002vee , Chain F 
Resolution 2.60 Å
Residue indices (Uniprot), coverage 6-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9949
auth_asym_id F
label_asym_ids of heme N
Available structure PDB
PDB ID:  pdb_00002vee , Chain G 
Resolution 2.60 Å
Residue indices (Uniprot), coverage 6-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9949
auth_asym_id G
label_asym_ids of heme O
Available structure PDB
PDB ID:  pdb_00002vee , Chain H 
Resolution 2.60 Å
Residue indices (Uniprot), coverage 6-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9949
auth_asym_id H
label_asym_ids of heme P
Available structure PDB
PDB ID:  pdb_00003zjr , Chain A 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 6-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9949
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00003zjr , Chain A-1 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 6-195 (1-195), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C101S
Insertions None
Deletions None
Sequence identity to UniProt 0.9949
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB