Danish
Uniprot ID:  Q9EW92
  • Protein: PimD protein
  • Organism: Streptomyces natalensis
  • Length: 397
  • Sequence:
    • MTAASHDLPCLNLEPPKMLKLSPLLRALQDRGPIHRVRTPAGDEAWLVTRHAELKQLLHDERIGRTHPDPPSAAQYVRSPFLDLLISDADAESGRRQHAETRRLLTPLFSARRVLEMQPKVEEAADTLLDAFIAQGPPGDLHGELTVPFALTVLCEVIGVPPQRRAELTTLLAGIAKLDDREGAVRAQDDLFGYVAGLVEHKRAEPGPDIISRLNDGELTEDRVAHLAMGLLFAGLDSVASIMDNGVVLLAAHPDQRAAALADPDVMARAVEEVLRTARAGGSVLPPRYASEDMEFGGVTIRAGDLVLFDLGLPNFDERAFTGPEEFDAARTPNPHLTFGHGIWHCIGAPLARLELRTMFTKLFTRLPELRPELPVEQLRLKEGQLSGGFAELRVVW
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00002xbk , Chain A 
Resolution 1.95 Å
Residue indices (Uniprot), coverage 7-397 (5-397), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) T2H, A3H, A4G
Insertions 1insRGSHHHH
Deletions None
Sequence identity to UniProt 0.9924
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00002x9p , Chain A 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 5-397 (5-397), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) T2H, A3H, A4G
Insertions 1insRGSHHHH
Deletions None
Sequence identity to UniProt 0.9924
auth_asym_id A
Missing residues 382LYS-389GLY
Structural gaps Exists
label_asym_ids of heme B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å