Danish
Uniprot ID:  Q9HVY6
  • Protein: Probable cytochrome c1
  • Organism: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
  • Length: 260
  • Sequence:
    • MKKQFAALILAVLPVLGFAAGGHGPQLDHVDIDLTDKAAMQDGARTFANYCMGCHSAKFQRYERVATDLGIPADLMMEKLVFTGAKIGDHMDIGMKPADAKTWFGAAPPDLTLVARVRGTDWLYSYLRSFYEDPKRPWGVNNVIFPNVGMPNVLAPLQGRQVIGCKQVQVVEDGKKQFDPLTGTPLTHEACDQLTVVPKTGELNEAQFDEKVKNLVTFLAYSANPNKLASERIGTYVLLYLAFFFVFAYLLKREYWKDVH
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00008smr , Chain C 
Residue indices (Uniprot), coverage 26-257 (25-257), 0.90
Mutations (UniProt numbering) None
Insertions None
Deletions M1-G24, D258-H260
Sequence identity to UniProt 1.0000
auth_asym_id J
label_asym_ids of heme S
Available structure PDB
PDB ID:  pdb_00008smr , Chain H 
Residue indices (Uniprot), coverage 25-257 (25-257), 0.90
Mutations (UniProt numbering) None
Insertions None
Deletions M1-G24, D258-H260
Sequence identity to UniProt 1.0000
auth_asym_id M
Structural gaps Exists
label_asym_ids of heme AA
Available structure PDB
PDB ID:  pdb_00008snh , Chain D 
Residue indices (Uniprot), coverage 26-257 (25-257), 0.90
Mutations (UniProt numbering) None
Insertions None
Deletions M1-G24, D258-H260
Sequence identity to UniProt 1.0000
auth_asym_id J
label_asym_ids of heme X
Available structure PDB
PDB ID:  pdb_00008snh , Chain I 
Residue indices (Uniprot), coverage 25-257 (25-257), 0.90
Mutations (UniProt numbering) None
Insertions None
Deletions M1-G24, D258-H260
Sequence identity to UniProt 1.0000
auth_asym_id M
Structural gaps Exists
label_asym_ids of heme FA
Available structure PDB