Danish
Uniprot ID:  Q9HX49
  • Protein: Globin domain-containing protein
  • Organism: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
  • Length: 130
  • Sequence:
    • MNAADRVMQSYGRCCASTGFFDDFYRHFLASSPQIRAKFATTDMTAQKHLLRAGIMNLVMYARGMSDSKLRALGASHSRAALDIRPELYDLWLDALLMAVAEHDRDCDAETRDAWRDVMGRGIAVIKSYY
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  1
PDB ID:  pdb_00001tu9 , Chain A 
Resolution 1.20 Å
Residue indices (Uniprot), coverage 2-132 (1-130), 1.00
Difference from Uniprot sequence cloning artifact
Mutations (UniProt numbering) None
Insertions 0insGH, 130insGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB