Danish
Uniprot ID:  Q9LCV0
  • Protein: SoxX protein
  • Organism: Paracoccus denitrificans
  • Length: 157
  • Sequence:
    • MSSHLWYASVVAMAIATPAICETAPKEVVYVEGAVEASLTGAPGNPEEGVRIMTTNALGNCVACHQIGALPDVEFPGTIAPPLDGAGDRWTEAQLRGIVANAKMTFEGTFMPAFYKVDGFVRPGDGFSGKAGAEPLAPILNAQQIEDVVAFLVTLKE
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00002c1d , Chain B 
Resolution 1.92 Å
Residue indices (Uniprot), coverage 21-157 (21-157), 0.87
Mutations (UniProt numbering) None
Insertions None
Deletions M1-I20
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme O
Available structure PDB
PDB ID:  pdb_00002c1d , Chain D 
Resolution 1.92 Å
Residue indices (Uniprot), coverage 21-157 (21-157), 0.87
Mutations (UniProt numbering) None
Insertions None
Deletions M1-I20
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme U
Available structure PDB
PDB ID:  pdb_00002c1d , Chain F 
Resolution 1.92 Å
Residue indices (Uniprot), coverage 21-157 (21-157), 0.87
Mutations (UniProt numbering) None
Insertions None
Deletions M1-I20
Sequence identity to UniProt 1.0000
auth_asym_id F
label_asym_ids of heme Z
Available structure PDB
PDB ID:  pdb_00002c1d , Chain H 
Resolution 1.92 Å
Residue indices (Uniprot), coverage 21-157 (21-157), 0.87
Mutations (UniProt numbering) None
Insertions None
Deletions M1-I20
Sequence identity to UniProt 1.0000
auth_asym_id H
label_asym_ids of heme FA
Available structure PDB