Danish
Uniprot ID:  Q9M593
  • Protein: Anaerobic nitrite reductase GLB1
  • Organism: Balsas teosinte (Zea mays subsp. parviglumis)
  • Length: 165
  • Sequence:
    • MALAEADDGAVVFGEEQEALVLKSWAVMKKDAANLGLRFFLKVFEIAPSAKQMFSFLRDSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRETTLKRLGATHLRYGVADGHFEVTGFALLETIKEALPADMWSLEMKKAWAEAYSQLVAAIKREMKPDA
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00002r50 , Chain A 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 11-165 (1-165), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 55SER-63PRO
Structural gaps Exists
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00002r50 , Chain B 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 11-165 (1-165), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
Missing residues 56PHE-64LEU
Structural gaps Exists
label_asym_ids of heme G
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.16 Å
PDB ID:  pdb_00002r50 , Chain C 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 12-165 (1-165), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
Missing residues 57LEU-63PRO
Structural gaps Exists
label_asym_ids of heme K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.16 Å
PDB ID:  pdb_00002r50 , Chain D 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 12-165 (1-165), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id D
Missing residues 56PHE-64LEU
Structural gaps Exists
label_asym_ids of heme N
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.20 Å