Danish
Uniprot ID:  Q9R638
  • Protein: Cytochrome C3=26 kDa subunit of A dimeric class III C-type cytochrome
  • Organism: Desulfovibrio gigas (Megalodesulfovibrio gigas)
  • Length: 109
  • Sequence:
    • LDVPCKVVITAPEGEDPHPRFGKVEMSHAKHRNVSCVSCHHMFDGCGDFQKCADCHIDRDDRSYERGFYKAWHSESEISCRGCHKAMKAKNEQTGPIGCLQGCHEAAQK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00001gyo , Chain A 
Resolution 1.20 Å
Residue indices (Uniprot), coverage 1-106 (1-109), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme F ,  E ,  D ,  C
Available structure PDB
PDB ID:  pdb_00001gyo , Chain B 
Resolution 1.20 Å
Residue indices (Uniprot), coverage 1-106 (1-109), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme J ,  I ,  H ,  G
Available structure PDB