- Protein: Deferrochelatase
- Organism:
- Length: 420
- Sequence:
MTDTDSPAPAPSPSRRSLIGWGGAGLALGAAAAAGGAVAMDRAGADADPAGADAGSAVPFHGAHQAGIATPVQDRLHFAAFDVTTEDRAAFVALLKEWTAAARRLTAGHAVGEGAYGGLPEAPPDDTGEALGLKPSRLTLTIGFGPSLFTRFGLADLRPEALADLPKFPGDNLDRARSGGDLCVQACADDPQVAVHAIRNLARIGFGKVVVRWSQLGFGKTSSTTPDEQTPRNLLGFKDGTRNIAGTEKDRLDRFVWAAEKDGTPWMTGGSYLVARRIRMHIETWDRASLQEQEDVFGRDKGEGAPVGKAKERDEPFLKAMKPDAHVRLAHPDSNGGATLLRRGYSFTDGTDGLGRLDAGLFFLAYQRDIRTGFVPVQRNLATDALNEYIQHVGSAVFAVPPGVRDADDWWGSTLFGKEA
| Resolution | 1.73 Å |
|---|---|
| Residue indices (Uniprot), coverage | 55-416 (55-416), 0.86 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.73 Å |
|---|---|
| Residue indices (Uniprot), coverage | 56-416 (55-416), 0.86 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Resolution | 1.74 Å |
|---|---|
| Residue indices (Uniprot), coverage | 55-416 (55-416), 0.86 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.74 Å |
|---|---|
| Residue indices (Uniprot), coverage | 56-416 (55-416), 0.86 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Resolution | 1.78 Å |
|---|---|
| Residue indices (Uniprot), coverage | 55-416 (55-416), 0.86 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.78 Å |
|---|---|
| Residue indices (Uniprot), coverage | 56-416 (55-416), 0.86 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Resolution | 1.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 55-416 (48-420), 0.89 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 56-417 (48-420), 0.89 |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Resolution | 1.88 Å |
|---|---|
| Residue indices (Uniprot), coverage | 55-416 (48-420), 0.89 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.88 Å |
|---|---|
| Residue indices (Uniprot), coverage | 56-417 (48-420), 0.89 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Resolution | 1.88 Å |
|---|---|
| Residue indices (Uniprot), coverage | 55-416 (54-416), 0.86 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.88 Å |
|---|---|
| Residue indices (Uniprot), coverage | 55-416 (54-416), 0.86 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 1.93 Å |
|---|---|
| Residue indices (Uniprot), coverage | 55-416 (55-416), 0.86 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.93 Å |
|---|---|
| Residue indices (Uniprot), coverage | 56-416 (55-416), 0.86 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 56-417 (1-420), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| Structural gaps | Exists |
| label_asym_ids of heme | C |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.10 Å |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 56-417 (1-420), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| Structural gaps | Exists |
| label_asym_ids of heme | C-1 |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.11 Å |
| Resolution | 2.03 Å |
|---|---|
| Residue indices (Uniprot), coverage | 55-416 (55-416), 0.86 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 2.03 Å |
|---|---|
| Residue indices (Uniprot), coverage | 56-416 (55-416), 0.86 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Resolution | 2.18 Å |
|---|---|
| Residue indices (Uniprot), coverage | 55-416 (55-416), 0.86 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 2.18 Å |
|---|---|
| Residue indices (Uniprot), coverage | 56-416 (55-416), 0.86 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |