Danish
Uniprot ID:  Q9RKQ2
  • Protein: Deferrochelatase
  • Organism: Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
  • Length: 420
  • Sequence:
    • MTDTDSPAPAPSPSRRSLIGWGGAGLALGAAAAAGGAVAMDRAGADADPAGADAGSAVPFHGAHQAGIATPVQDRLHFAAFDVTTEDRAAFVALLKEWTAAARRLTAGHAVGEGAYGGLPEAPPDDTGEALGLKPSRLTLTIGFGPSLFTRFGLADLRPEALADLPKFPGDNLDRARSGGDLCVQACADDPQVAVHAIRNLARIGFGKVVVRWSQLGFGKTSSTTPDEQTPRNLLGFKDGTRNIAGTEKDRLDRFVWAAEKDGTPWMTGGSYLVARRIRMHIETWDRASLQEQEDVFGRDKGEGAPVGKAKERDEPFLKAMKPDAHVRLAHPDSNGGATLLRRGYSFTDGTDGLGRLDAGLFFLAYQRDIRTGFVPVQRNLATDALNEYIQHVGSAVFAVPPGVRDADDWWGSTLFGKEA
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  20
PDB ID:  pdb_00006i8p , Chain A 
Resolution 1.73 Å
Residue indices (Uniprot), coverage 55-416 (55-416), 0.86
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E228K
Insertions None
Deletions M1-A54, G417-A420
Sequence identity to UniProt 0.9972
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006i8p , Chain B 
Resolution 1.73 Å
Residue indices (Uniprot), coverage 56-416 (55-416), 0.86
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E228K
Insertions None
Deletions M1-A54, G417-A420
Sequence identity to UniProt 0.9972
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00006i8q , Chain A 
Resolution 1.74 Å
Residue indices (Uniprot), coverage 55-416 (55-416), 0.86
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E228K
Insertions None
Deletions M1-A54, G417-A420
Sequence identity to UniProt 0.9972
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006i8q , Chain B 
Resolution 1.74 Å
Residue indices (Uniprot), coverage 56-416 (55-416), 0.86
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E228K
Insertions None
Deletions M1-A54, G417-A420
Sequence identity to UniProt 0.9972
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00006i91 , Chain A 
Resolution 1.78 Å
Residue indices (Uniprot), coverage 55-416 (55-416), 0.86
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E228K
Insertions None
Deletions M1-A54, G417-A420
Sequence identity to UniProt 0.9972
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006i91 , Chain B 
Resolution 1.78 Å
Residue indices (Uniprot), coverage 56-416 (55-416), 0.86
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E228K
Insertions None
Deletions M1-A54, G417-A420
Sequence identity to UniProt 0.9972
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00006tb8 , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 55-416 (48-420), 0.89
Mutations (UniProt numbering) E228K
Insertions None
Deletions M1-A47
Sequence identity to UniProt 0.9973
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006tb8 , Chain B 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 56-417 (48-420), 0.89
Mutations (UniProt numbering) E228K
Insertions None
Deletions M1-A47
Sequence identity to UniProt 0.9973
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00006i43 , Chain A 
Resolution 1.88 Å
Residue indices (Uniprot), coverage 55-416 (48-420), 0.89
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E228K
Insertions None
Deletions M1-A47
Sequence identity to UniProt 0.9973
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006i43 , Chain B 
Resolution 1.88 Å
Residue indices (Uniprot), coverage 56-417 (48-420), 0.89
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E228K
Insertions None
Deletions M1-A47
Sequence identity to UniProt 0.9973
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00006i7c , Chain A 
Resolution 1.88 Å
Residue indices (Uniprot), coverage 55-416 (54-416), 0.86
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E228K
Insertions None
Deletions M1-D53, G417-A420
Sequence identity to UniProt 0.9972
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006i7c , Chain B 
Resolution 1.88 Å
Residue indices (Uniprot), coverage 55-416 (54-416), 0.86
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E228K
Insertions None
Deletions M1-D53, G417-A420
Sequence identity to UniProt 0.9972
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00006q3d , Chain A 
Resolution 1.93 Å
Residue indices (Uniprot), coverage 55-416 (55-416), 0.86
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E228K
Insertions None
Deletions M1-A54, G417-A420
Sequence identity to UniProt 0.9972
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006q3d , Chain B 
Resolution 1.93 Å
Residue indices (Uniprot), coverage 56-416 (55-416), 0.86
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E228K
Insertions None
Deletions M1-A54, G417-A420
Sequence identity to UniProt 0.9972
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00004grc , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 56-417 (1-420), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMGSSHHHHHHSSGLVPRGSH
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 353GLY-357LEU
Structural gaps Exists
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00004grc , Chain A-1 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 56-417 (1-420), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMGSSHHHHHHSSGLVPRGSH
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 353GLY-357LEU
Structural gaps Exists
label_asym_ids of heme C-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00006q3e , Chain A 
Resolution 2.03 Å
Residue indices (Uniprot), coverage 55-416 (55-416), 0.86
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E228K
Insertions None
Deletions M1-A54, G417-A420
Sequence identity to UniProt 0.9972
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006q3e , Chain B 
Resolution 2.03 Å
Residue indices (Uniprot), coverage 56-416 (55-416), 0.86
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E228K
Insertions None
Deletions M1-A54, G417-A420
Sequence identity to UniProt 0.9972
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00006ibn , Chain A 
Resolution 2.18 Å
Residue indices (Uniprot), coverage 55-416 (55-416), 0.86
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E228K
Insertions None
Deletions M1-A54, G417-A420
Sequence identity to UniProt 0.9972
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006ibn , Chain B 
Resolution 2.18 Å
Residue indices (Uniprot), coverage 56-416 (55-416), 0.86
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E228K
Insertions None
Deletions M1-A54, G417-A420
Sequence identity to UniProt 0.9972
auth_asym_id B
label_asym_ids of heme D
Available structure PDB