Danish
Uniprot ID:  Q9VF15
  • Protein: Globin 1, isoform A
  • Organism: Fruit fly (Drosophila melanogaster)
  • Length: 153
  • Sequence:
    • MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFNRFPSNLEKFPFRDVPLEELSGNARFRAHAGRIIRVFDESIQVLGQDGDLEKLDEIWTKIAVSHIPRTVSKESYNQLKGVILDVLTAACSLDESQAATWAKLVDHVYGIIFKAIDDDGNAK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00002bk9 , Chain A 
Resolution 1.20 Å
Residue indices (Uniprot), coverage 1-153 (1-153), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C121S, G140A
Insertions None
Deletions None
Sequence identity to UniProt 0.9869
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00002g3h , Chain A 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 1-153 (1-153), 1.00
Mutations (UniProt numbering) C121S
Insertions None
Deletions None
Sequence identity to UniProt 0.9935
auth_asym_id A
label_asym_ids of heme F
Available structure PDB