Danish
Uniprot ID:  R4ZGW6
  • Protein: Cytochrome b559 subunit alpha
  • Organism: Norway spruce (Picea abies)
  • Length: 83
  • Sequence:
    • MSGNTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESRQEVPLVTGRFDSLEQLDEFTRSF
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00008c29 , Chain BA 
Residue indices (Uniprot), coverage 19-83 (1-83), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id e
label_asym_ids of heme RK
Available structure PDB
PDB ID:  pdb_00008c29 , Chain E 
Residue indices (Uniprot), coverage 19-83 (1-83), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id E
label_asym_ids of heme SD
Available structure PDB