Danish
Uniprot ID:  R9RY64
  • Protein: Truncated hemoglobin 4
  • Organism: Chlamydomonas smithii (Chlamydomonas reinhardtii)
  • Length: 214
  • Sequence:
    • MAAVNNGAVPGNGANPLYGAELQGDGVKSTPQANAAPANVNGSVSSAGQSKSAATTRSTLHAKLGGAAAVAATVDVFYKKLMNDPDLEPFFRGVDMVTLIAKQNRFLAYAFGATTHYHGKDIVMGHAHLIINRGLNLTHFDKVAGHFVDSLKEMGVGQELIDEAAGVLIGVRPLFDPERYKGKVDVEKIEKAATTPQSKPAEAGQDAPACCTIM
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00006bme , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 32-158 (58-185), 0.60
Mutations (UniProt numbering) None
Insertions None
Deletions M1-R57, V186-M214
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006bme , Chain B 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 33-157 (58-185), 0.60
Mutations (UniProt numbering) None
Insertions None
Deletions M1-R57, V186-M214
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme E
Available structure PDB