Danish
Uniprot ID:  R9RZK8
  • Protein: Myoglobin
  • Organism: Bowhead whale (Balaena mysticetus)
  • Length: 154
  • Sequence:
    • MVLSDGEWQLVLNIWAKVEADVAGHGQDVLIRLFKGHPETLEKFDKFKHLKTEAEMKASEDLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGFQG
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00005ycj , Chain A 
Resolution 1.58 Å
Residue indices (Uniprot), coverage 0-153 (1-154), 1.00
Mutations (UniProt numbering) V2G, A16G
Insertions 0insGSH
Deletions None
Sequence identity to UniProt 0.9870
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00005ycj , Chain B 
Resolution 1.58 Å
Residue indices (Uniprot), coverage -3-153 (1-154), 1.00
Mutations (UniProt numbering) V2G, A16G
Insertions 0insGSH
Deletions None
Sequence identity to UniProt 0.9870
auth_asym_id B
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00005yci , Chain A 
Resolution 1.97 Å
Residue indices (Uniprot), coverage 0-153 (1-154), 1.00
Mutations (UniProt numbering) V2G, A16G
Insertions 0insGSH
Deletions None
Sequence identity to UniProt 0.9870
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00005yci , Chain B 
Resolution 1.97 Å
Residue indices (Uniprot), coverage -3-153 (1-154), 1.00
Mutations (UniProt numbering) V2G, A16G
Insertions 0insGSH
Deletions None
Sequence identity to UniProt 0.9870
auth_asym_id B
label_asym_ids of heme D
Available structure PDB