Danish
Uniprot ID:  R9S002
  • Protein: Myoglobin
  • Organism: Northern elephant seal (Mirounga angustirostris)
  • Length: 154
  • Sequence:
    • MGLSDGEWHLVLNIWGKVETDLAGHGQEVLIRLFRSHPETLEKFDKFKHLKSEDDMRRSEDLRKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIQVLHNKHPGEFGADTQAAMKKALELFRNDIATKYKELGFHG
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00007ddu , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 0-153 (1-154), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00007ddu , Chain B 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 0-153 (1-154), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme L
Available structure PDB