Danish

Uniprot ID: S0BBU7

Protein: Extracellular globin
Organism: Hydrothermal vent tubeworm (Lamellibrachia satsuma)
Length: 165
Sequence:

MKVPGMLLLLLGLAAYASADCNILQRLKVKMQWAKAYGFGTERAKFGNSLWTSIFNYAPDARDLFKSVKSEDMRSPQFKAHIARVIGGLDRVISMFDNEDALNADLEHLKSQHDPRGLDALNFVVFGKALFATVGGQFGVCFDLPAWESCYKVIAMGITGNDMFS

Number of chains: 48

PDB ID: 7vld , Chain A
Resolution	2.10 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	A
label_asym_ids of heme	K
Available structure	PDB

PDB ID: 7vld , Chain A-1
Resolution	2.10 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	A
label_asym_ids of heme	K-1
Available structure	PDB

PDB ID: 7vld , Chain A-2
Resolution	2.10 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	A
label_asym_ids of heme	K-2
Available structure	PDB

PDB ID: 7vld , Chain E
Resolution	2.10 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	E
label_asym_ids of heme	T
Available structure	PDB

PDB ID: 7vld , Chain E-1
Resolution	2.10 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	E
label_asym_ids of heme	T-1
Available structure	PDB

PDB ID: 7vld , Chain E-2
Resolution	2.10 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	E
label_asym_ids of heme	T-2
Available structure	PDB

PDB ID: 7vlc , Chain A
Resolution	2.20 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	A
label_asym_ids of heme	K
Available structure	PDB

PDB ID: 7vlc , Chain A-1
Resolution	2.20 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	A
label_asym_ids of heme	K-1
Available structure	PDB

PDB ID: 7vlc , Chain A-2
Resolution	2.20 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	A
label_asym_ids of heme	K-2
Available structure	PDB

PDB ID: 7vlc , Chain E
Resolution	2.20 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	E
label_asym_ids of heme	T
Available structure	PDB

PDB ID: 7vlc , Chain E-1
Resolution	2.20 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	E
label_asym_ids of heme	T-1
Available structure	PDB

PDB ID: 7vlc , Chain E-2
Resolution	2.20 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	E
label_asym_ids of heme	T-2
Available structure	PDB

PDB ID: 7vle , Chain A
Resolution	2.30 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	A
label_asym_ids of heme	K
Available structure	PDB

PDB ID: 7vle , Chain A-1
Resolution	2.30 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	A
label_asym_ids of heme	K-1
Available structure	PDB

PDB ID: 7vle , Chain A-2
Resolution	2.30 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	A
label_asym_ids of heme	K-2
Available structure	PDB

PDB ID: 7vle , Chain E
Resolution	2.30 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	E
label_asym_ids of heme	S
Available structure	PDB

PDB ID: 7vle , Chain E-1
Resolution	2.30 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	E
label_asym_ids of heme	S-1
Available structure	PDB

PDB ID: 7vle , Chain E-2
Resolution	2.30 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	E
label_asym_ids of heme	S-2
Available structure	PDB

PDB ID: 3wct , Chain A
Resolution	2.40 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	A
label_asym_ids of heme	K
Available structure	PDB

PDB ID: 3wct , Chain A-1
Resolution	2.40 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	A
label_asym_ids of heme	K-1
Available structure	PDB

PDB ID: 3wct , Chain A-2
Resolution	2.40 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	A
label_asym_ids of heme	K-2
Available structure	PDB

PDB ID: 3wct , Chain E
Resolution	2.40 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	E
label_asym_ids of heme	T
Available structure	PDB

PDB ID: 3wct , Chain E-1
Resolution	2.40 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	E
label_asym_ids of heme	T-1
Available structure	PDB

PDB ID: 3wct , Chain E-2
Resolution	2.40 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	E
label_asym_ids of heme	T-2
Available structure	PDB

PDB ID: 7vlf , Chain A
Resolution	2.40 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	A
label_asym_ids of heme	K
Available structure	PDB

PDB ID: 7vlf , Chain A-1
Resolution	2.40 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	A
label_asym_ids of heme	K-1
Available structure	PDB

PDB ID: 7vlf , Chain A-2
Resolution	2.40 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	A
label_asym_ids of heme	K-2
Available structure	PDB

PDB ID: 7vlf , Chain E
Resolution	2.40 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	E
label_asym_ids of heme	R
Available structure	PDB

PDB ID: 7vlf , Chain E-1
Resolution	2.40 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	E
label_asym_ids of heme	R-1
Available structure	PDB

PDB ID: 7vlf , Chain E-2
Resolution	2.40 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	E
label_asym_ids of heme	R-2
Available structure	PDB

PDB ID: 3wcw , Chain A
Resolution	2.50 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	A
label_asym_ids of heme	K
Available structure	PDB

PDB ID: 3wcw , Chain A-1
Resolution	2.50 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	A
label_asym_ids of heme	K-1
Available structure	PDB

PDB ID: 3wcw , Chain A-2
Resolution	2.50 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	A
label_asym_ids of heme	K-2
Available structure	PDB

PDB ID: 3wcw , Chain E
Resolution	2.50 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	E
label_asym_ids of heme	U
Available structure	PDB

PDB ID: 3wcw , Chain E-1
Resolution	2.50 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	E
label_asym_ids of heme	U-1
Available structure	PDB

PDB ID: 3wcw , Chain E-2
Resolution	2.50 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	E
label_asym_ids of heme	U-2
Available structure	PDB

PDB ID: 3wcv , Chain A
Resolution	2.60 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	A
label_asym_ids of heme	K
Available structure	PDB

PDB ID: 3wcv , Chain A-1
Resolution	2.60 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	A
label_asym_ids of heme	K-1
Available structure	PDB

PDB ID: 3wcv , Chain A-2
Resolution	2.60 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	A
label_asym_ids of heme	K-2
Available structure	PDB

PDB ID: 3wcv , Chain E
Resolution	2.60 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	E
label_asym_ids of heme	V
Available structure	PDB

PDB ID: 3wcv , Chain E-1
Resolution	2.60 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	E
label_asym_ids of heme	V-1
Available structure	PDB

PDB ID: 3wcv , Chain E-2
Resolution	2.60 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	E
label_asym_ids of heme	V-2
Available structure	PDB

PDB ID: 3wcu , Chain A
Resolution	2.90 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	A
label_asym_ids of heme	K
Available structure	PDB

PDB ID: 3wcu , Chain A-1
Resolution	2.90 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	A
label_asym_ids of heme	K-1
Available structure	PDB

PDB ID: 3wcu , Chain A-2
Resolution	2.90 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	A
label_asym_ids of heme	K-2
Available structure	PDB

PDB ID: 3wcu , Chain E
Resolution	2.90 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	E
label_asym_ids of heme	P
Available structure	PDB

PDB ID: 3wcu , Chain E-1
Resolution	2.90 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	E
label_asym_ids of heme	P-1
Available structure	PDB

PDB ID: 3wcu , Chain E-2
Resolution	2.90 Å
Residue indices (Uniprot), coverage	1-146 (20-165), 0.88
auth_asym_id	E
label_asym_ids of heme	P-2
Available structure	PDB