Danish
Uniprot ID:  T0HHY7
  • Protein: Styrene-oxide isomerase
  • Organism: Sphingobium lactosutens DS20
  • Length: 181
  • Sequence:
    • MATLAAQPPVGGVDAAPDLERERAALRKMMIGNGVLMIFAALVGGLGLWMYLIGGFIPIFPGFHWDFQLPGTAEGWARAHTGPVLNGLMVITVAFCLPLLSFTPKWARIWGLIVVLDGWSNTGFYFFGNFAPNRGLNFTANRFGEANIFSFLALAPAYLFGVLVMIALFAIGIQALRDARR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  3
PDB ID:  pdb_000030tw , Chain A 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 15-181 (14-181), 1.00
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) A2G, T3L, L4E, A5V, A6L, Q7F, P8Q, P9G, V10P, G12T, V13M
Insertions 1insGHHHHHH
Deletions None
Sequence identity to UniProt 0.9392
auth_asym_id A
label_asym_ids of heme P
Available structure PDB
PDB ID:  pdb_000030tw , Chain B 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 15-181 (14-181), 1.00
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) A2G, T3L, L4E, A5V, A6L, Q7F, P8Q, P9G, V10P, G12T, V13M
Insertions 1insGHHHHHH
Deletions None
Sequence identity to UniProt 0.9392
auth_asym_id B
label_asym_ids of heme EA
Available structure PDB
PDB ID:  pdb_000030tw , Chain C 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 15-181 (14-181), 1.00
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) A2G, T3L, L4E, A5V, A6L, Q7F, P8Q, P9G, V10P, G12T, V13M
Insertions 1insGHHHHHH
Deletions None
Sequence identity to UniProt 0.9392
auth_asym_id C
label_asym_ids of heme IA
Available structure PDB