Danish
Uniprot ID:  U5KNG4
  • Protein: HBB protein
  • Organism: Southern American pika (Ochotona princeps)
  • Length: 147
  • Sequence:
    • MVHLSAEEKAAVTALWGKVNVDEVGGETLGRLLVVYPWTQRFFETFGELSLASAVMGNAKVKAHGKKVMNAFSEGLHHLDNLKGTFAKLSELHCDKLHVDPENFKLLGNVLVVVLSHHLGGEFTPQAQAAWQKVVSGVANALAHKYH
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  1
PDB ID:  pdb_00005eui , Chain B 
Resolution 1.45 Å
Residue indices (Uniprot), coverage 1-146 (2-147), 0.99
Difference from Uniprot sequence see remark 999
Mutations (UniProt numbering) A6G, E48D, L51S
Insertions None
Deletions M1
Sequence identity to UniProt 0.9795
auth_asym_id B
label_asym_ids of heme D
Available structure PDB