Danish
Uniprot ID:  W0DLP1
  • Protein: Cytochrome C
  • Organism: Thioalkalivibrio paradoxus ARh 1
  • Length: 105
  • Sequence:
    • MKKLMVVVAGVIMASGMASAHAADIEAGKAKYESTCLSCHGAEGKGQAIFPAVTGQDAAYVTEKLEQYRAGEQVGQHTALMAPHARTLSDEDIANLAAYIDAEFN
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00008yts , Chain A 
Resolution 1.15 Å
Residue indices (Uniprot), coverage 23-105 (1-105), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00008yts , Chain B 
Resolution 1.15 Å
Residue indices (Uniprot), coverage 23-105 (1-105), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme D
Available structure PDB