Danish

Uniprot ID: W0S1X5

Protein: Photosystem II reaction center protein Y
Organism: Red alga (Porphyridium purpureum)
Length: 36
Sequence:

MDTRLLIVLLPVLAAASWALYNIGRVALQQFKRLGS

Number of chains: 14

PDB ID: 7y5e , Chain DX
Residue indices (Uniprot), coverage	2-34 (2-34), 0.92
auth_asym_id	r6
label_asym_ids of heme	None
Available structure	PDB

PDB ID: 7y5e , Chain EW
Residue indices (Uniprot), coverage	2-34 (2-34), 0.92
auth_asym_id	R6
label_asym_ids of heme	QRC
Available structure	PDB

PDB ID: 7y5e , Chain KFA
Residue indices (Uniprot), coverage	2-34 (2-34), 0.92
auth_asym_id	rL
label_asym_ids of heme	None
Available structure	PDB

PDB ID: 7y5e , Chain PJ
Residue indices (Uniprot), coverage	2-34 (2-34), 0.92
auth_asym_id	RL
label_asym_ids of heme	None
Available structure	PDB

PDB ID: 7y7a , Chain NL
Residue indices (Uniprot), coverage	2-34 (2-34), 0.92
auth_asym_id	r9
label_asym_ids of heme	None
Available structure	PDB

PDB ID: 7y7a , Chain NT
Residue indices (Uniprot), coverage	2-34 (2-34), 0.92
auth_asym_id	rE
label_asym_ids of heme	None
Available structure	PDB

PDB ID: 7y7a , Chain OK
Residue indices (Uniprot), coverage	2-34 (2-34), 0.92
auth_asym_id	R9
label_asym_ids of heme	None
Available structure	PDB

PDB ID: 7y7a , Chain OS
Residue indices (Uniprot), coverage	2-34 (2-34), 0.92
auth_asym_id	RE
label_asym_ids of heme	None
Available structure	PDB

PDB ID: 7y7a , Chain PEA
Residue indices (Uniprot), coverage	2-34 (2-34), 0.92
auth_asym_id	rO
label_asym_ids of heme	None
Available structure	PDB

PDB ID: 7y7a , Chain QDA
Residue indices (Uniprot), coverage	2-34 (2-34), 0.92
auth_asym_id	RO
label_asym_ids of heme	XQE
Available structure	PDB

PDB ID: 7y7a , Chain QLB
Residue indices (Uniprot), coverage	2-34 (2-34), 0.92
auth_asym_id	rm
label_asym_ids of heme	None
Available structure	PDB

PDB ID: 7y7a , Chain RKB
Residue indices (Uniprot), coverage	2-34 (2-34), 0.92
auth_asym_id	Rm
label_asym_ids of heme	None
Available structure	PDB

PDB ID: 7y7a , Chain YTA
Residue indices (Uniprot), coverage	2-34 (2-34), 0.92
auth_asym_id	rZ
label_asym_ids of heme	None
Available structure	PDB

PDB ID: 7y7a , Chain ZSA
Residue indices (Uniprot), coverage	2-34 (2-34), 0.92
auth_asym_id	RZ
label_asym_ids of heme	JCG
Available structure	PDB