Danish
Uniprot ID:  W0S1X5
  • Protein: Photosystem II reaction center protein Y
  • Organism: Red alga (Porphyridium purpureum)
  • Length: 36
  • Sequence:
    • MDTRLLIVLLPVLAAASWALYNIGRVALQQFKRLGS
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00007y5e , Chain DX 
Residue indices (Uniprot), coverage 2-34 (2-34), 0.92
Mutations (UniProt numbering) None
Insertions None
Deletions M1, G35-S36
Sequence identity to UniProt 1.0000
auth_asym_id r6
label_asym_ids of heme None
Available structure PDB
PDB ID:  pdb_00007y5e , Chain EW 
Residue indices (Uniprot), coverage 2-34 (2-34), 0.92
Mutations (UniProt numbering) None
Insertions None
Deletions M1, G35-S36
Sequence identity to UniProt 1.0000
auth_asym_id R6
label_asym_ids of heme QRC
Available structure PDB
PDB ID:  pdb_00007y5e , Chain KFA 
Residue indices (Uniprot), coverage 2-34 (2-34), 0.92
Mutations (UniProt numbering) None
Insertions None
Deletions M1, G35-S36
Sequence identity to UniProt 1.0000
auth_asym_id rL
label_asym_ids of heme None
Available structure PDB
PDB ID:  pdb_00007y5e , Chain PJ 
Residue indices (Uniprot), coverage 2-34 (2-34), 0.92
Mutations (UniProt numbering) None
Insertions None
Deletions M1, G35-S36
Sequence identity to UniProt 1.0000
auth_asym_id RL
label_asym_ids of heme None
Available structure PDB