- Protein: Cytochrome c6
- Organism: Red alga (Porphyridium purpureum)
- Length: 110
- Sequence:
MKKSFSMIAIAMITSFCLFTTNVFAADIEHGEQIFTANCSACHAGGNNVIMPEKTLKKDALEANGMNSVSAITNQVTNGKNAMPAFGGRLADNDIEDVANYVLAQSVKGW
| Residue indices (Uniprot), coverage | 27-110 (7-110), 0.95 |
|---|---|
| auth_asym_id | GN |
| label_asym_ids of heme | ZNB |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 27-110 (7-110), 0.95 |
|---|---|
| auth_asym_id | G2 |
| label_asym_ids of heme | KGC |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 27-110 (27-110), 0.76 |
|---|---|
| auth_asym_id | G7 |
| label_asym_ids of heme | ORC |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 27-110 (27-110), 0.76 |
|---|---|
| auth_asym_id | Go |
| label_asym_ids of heme | UFI |
| Available structure | PDB |