Danish
Uniprot ID:  P80592
  • Protein: Giant hemoglobins B chain
  • Organism: Vent tube worm (Riftia pachyptila)
  • Length: 144
  • Sequence:
    • DYVCGPLQRLKVKRQWAEAYGSGNSREEFGHFIWSHVFQHSPAARDMFKRVRGDNIHTPAFRAHATRVLGGLDMCIALLDDEPVLNTQLAHLAKQHETRGVEAAHYDTVNHAVMMGVENVIGSEVFDQDAWKPCLNVITNGIQG
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  6
PDB ID:  pdb_00001yhu , Chain B 
Resolution 3.15 Å
Residue indices (Uniprot), coverage 1-144 (1-144), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme CA
Available structure PDB
PDB ID:  pdb_00001yhu , Chain F 
Resolution 3.15 Å
Residue indices (Uniprot), coverage 1-144 (1-144), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id F
label_asym_ids of heme MA
Available structure PDB
PDB ID:  pdb_00001yhu , Chain J 
Resolution 3.15 Å
Residue indices (Uniprot), coverage 1-144 (1-144), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id J
label_asym_ids of heme WA
Available structure PDB
PDB ID:  pdb_00001yhu , Chain N 
Resolution 3.15 Å
Residue indices (Uniprot), coverage 1-144 (1-144), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id N
label_asym_ids of heme GB
Available structure PDB
PDB ID:  pdb_00001yhu , Chain R 
Resolution 3.15 Å
Residue indices (Uniprot), coverage 1-144 (1-144), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id R
label_asym_ids of heme QB
Available structure PDB
PDB ID:  pdb_00001yhu , Chain V 
Resolution 3.15 Å
Residue indices (Uniprot), coverage 1-144 (1-144), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id V
label_asym_ids of heme AC
Available structure PDB