- Protein: Cytochrome c1 2, heme protein, mitochondrial
- Organism: Mouse-ear cress (Arabidopsis thaliana)
- Length: 307
- Sequence:
MVGGGVIRQLLRRKLHSQSVATPVLSWLSSKKANEDAGSAGLRAFALMGAGITGLLSFSTVASADEAEHGLECPNYPWPHEGILSSYDHASIRRGHQVYQQVCASCHSMSLISYRDLVGVAYTEEEAKAMAAEIEVVDGPNDEGEMFTRPGKLSDRLPEPYSNESAARFANGGAYPPDLSLVTKARHNGQNYVFALLTGYRDPPAGISIREGLHYNPYFPGGAIAMPKMLNDEAVEYEDGTPATEAQMGKDVVSFLSWAAEPEMEERKLMGFKWIFLLSLALLQAAYYRRLKWSVLKSRKLVLDVVN
| Residue indices (Uniprot), coverage | 64-307 (1-307), 1.00 |
|---|---|
| Difference from Uniprot sequence | variant |
| auth_asym_id | E |
| label_asym_ids of heme | AA |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 64-307 (1-307), 1.00 |
|---|---|
| auth_asym_id | O |
| label_asym_ids of heme | VA |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 64-307 (1-307), 1.00 |
|---|---|
| auth_asym_id | BE |
| label_asym_ids of heme | WE |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 64-307 (1-307), 1.00 |
|---|---|
| auth_asym_id | AE |
| label_asym_ids of heme | CE |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 64-307 (1-307), 1.00 |
|---|---|
| auth_asym_id | BE |
| label_asym_ids of heme | TC |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 64-307 (1-307), 1.00 |
|---|---|
| auth_asym_id | AE |
| label_asym_ids of heme | MC |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 64-307 (1-307), 1.00 |
|---|---|
| auth_asym_id | BE |
| label_asym_ids of heme | TC |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 64-307 (1-307), 1.00 |
|---|---|
| auth_asym_id | AE |
| label_asym_ids of heme | MC |
| Available structure | PDB |