Danish

Uniprot ID: W0RYH5

Protein: Cytochrome b559 subunit alpha
Organism: Red alga (Porphyridium purpureum)
Length: 84
Sequence:

MSGGSTGERPFSDIITSIRYWVIHSITIPSLFVAGWLFVSTGLAYDVFGTPRPNEYFTQDRQQVPLVNDRFSAKQELEDLTKGL

Number of chains: 14

PDB ID: 7y5e , Chain DJ
Residue indices (Uniprot), coverage	4-81 (1-84), 1.00
auth_asym_id	EL
label_asym_ids of heme	None
Available structure	PDB

PDB ID: 7y5e , Chain RW
Residue indices (Uniprot), coverage	3-81 (1-84), 1.00
auth_asym_id	e6
label_asym_ids of heme	XUC
Available structure	PDB

PDB ID: 7y5e , Chain SV
Residue indices (Uniprot), coverage	4-81 (1-84), 1.00
auth_asym_id	E6
label_asym_ids of heme	QRC
Available structure	PDB

PDB ID: 7y5e , Chain YEA
Residue indices (Uniprot), coverage	3-81 (1-84), 1.00
auth_asym_id	eL
label_asym_ids of heme	DQD
Available structure	PDB

PDB ID: 7y7a , Chain BL
Residue indices (Uniprot), coverage	3-81 (1-84), 1.00
auth_asym_id	e9
label_asym_ids of heme	UBD
Available structure	PDB

PDB ID: 7y7a , Chain BT
Residue indices (Uniprot), coverage	3-81 (1-84), 1.00
auth_asym_id	eE
label_asym_ids of heme	VSD
Available structure	PDB

PDB ID: 7y7a , Chain CK
Residue indices (Uniprot), coverage	4-81 (1-84), 1.00
auth_asym_id	E9
label_asym_ids of heme	None
Available structure	PDB

PDB ID: 7y7a , Chain CS
Residue indices (Uniprot), coverage	4-81 (1-84), 1.00
auth_asym_id	EE
label_asym_ids of heme	None
Available structure	PDB

PDB ID: 7y7a , Chain DEA
Residue indices (Uniprot), coverage	3-81 (1-84), 1.00
auth_asym_id	eO
label_asym_ids of heme	GUE
Available structure	PDB

PDB ID: 7y7a , Chain EDA
Residue indices (Uniprot), coverage	4-81 (1-84), 1.00
auth_asym_id	EO
label_asym_ids of heme	XQE
Available structure	PDB

PDB ID: 7y7a , Chain ELB
Residue indices (Uniprot), coverage	3-81 (1-84), 1.00
auth_asym_id	em
label_asym_ids of heme	QUH
Available structure	PDB

PDB ID: 7y7a , Chain FKB
Residue indices (Uniprot), coverage	4-81 (1-84), 1.00
auth_asym_id	Em
label_asym_ids of heme	None
Available structure	PDB

PDB ID: 7y7a , Chain MTA
Residue indices (Uniprot), coverage	3-81 (1-84), 1.00
auth_asym_id	eZ
label_asym_ids of heme	RFG
Available structure	PDB

PDB ID: 7y7a , Chain NSA
Residue indices (Uniprot), coverage	4-81 (1-84), 1.00
auth_asym_id	EZ
label_asym_ids of heme	JCG
Available structure	PDB