Danish
Uniprot ID:  W0RYH5
  • Protein: Cytochrome b559 subunit alpha
  • Organism: Red alga (Porphyridium purpureum)
  • Length: 84
  • Sequence:
    • MSGGSTGERPFSDIITSIRYWVIHSITIPSLFVAGWLFVSTGLAYDVFGTPRPNEYFTQDRQQVPLVNDRFSAKQELEDLTKGL
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00007y5e , Chain DJ 
Residue indices (Uniprot), coverage 4-81 (1-84), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id EL
label_asym_ids of heme None
Available structure PDB
PDB ID:  pdb_00007y5e , Chain RW 
Residue indices (Uniprot), coverage 3-81 (1-84), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id e6
label_asym_ids of heme XUC
Available structure PDB
PDB ID:  pdb_00007y5e , Chain SV 
Residue indices (Uniprot), coverage 4-81 (1-84), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id E6
label_asym_ids of heme QRC
Available structure PDB
PDB ID:  pdb_00007y5e , Chain YEA 
Residue indices (Uniprot), coverage 3-81 (1-84), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id eL
label_asym_ids of heme DQD
Available structure PDB