Danish

Uniprot ID: W0RYZ6

Protein: Cytochrome c550
Organism: Red alga (Porphyridium purpureum)
Length: 162
Sequence:

MLKKVFWQPVIIGLIVLLSSEYVLAIELDDITRTIPLEASGTTITLTPEQVKRGKRLFNSSCAICHNGGITKTNPNVGLDPESLSLATPPRDNVNSLIDYMKDPTSYDGSESIAEIHPSIKSADIFPKMRSLSDDDLFAIAGHILIQPKVASEKWGGGKIYY

Number of chains: 14

PDB ID: 7y5e , Chain GX
Residue indices (Uniprot), coverage	4-137 (1-162), 1.00
auth_asym_id	v6
label_asym_ids of heme	KVC
Available structure	PDB

PDB ID: 7y5e , Chain IW
Residue indices (Uniprot), coverage	4-137 (1-162), 1.00
auth_asym_id	V6
label_asym_ids of heme	FSC
Available structure	PDB

PDB ID: 7y5e , Chain NFA
Residue indices (Uniprot), coverage	4-137 (1-162), 1.00
auth_asym_id	vL
label_asym_ids of heme	OQD
Available structure	PDB

PDB ID: 7y5e , Chain TJ
Residue indices (Uniprot), coverage	4-137 (1-162), 1.00
auth_asym_id	VL
label_asym_ids of heme	IHB
Available structure	PDB

PDB ID: 7y7a , Chain BUA
Residue indices (Uniprot), coverage	4-137 (1-162), 1.00
auth_asym_id	vZ
label_asym_ids of heme	EGG
Available structure	PDB

PDB ID: 7y7a , Chain DTA
Residue indices (Uniprot), coverage	4-137 (1-162), 1.00
auth_asym_id	VZ
label_asym_ids of heme	ZCG
Available structure	PDB

PDB ID: 7y7a , Chain QL
Residue indices (Uniprot), coverage	4-137 (1-162), 1.00
auth_asym_id	v9
label_asym_ids of heme	FCD
Available structure	PDB

PDB ID: 7y7a , Chain RT
Residue indices (Uniprot), coverage	4-137 (1-162), 1.00
auth_asym_id	vE
label_asym_ids of heme	GTD
Available structure	PDB

PDB ID: 7y7a , Chain SEA
Residue indices (Uniprot), coverage	4-137 (1-162), 1.00
auth_asym_id	vO
label_asym_ids of heme	TUE
Available structure	PDB

PDB ID: 7y7a , Chain SK
Residue indices (Uniprot), coverage	4-137 (1-162), 1.00
auth_asym_id	V9
label_asym_ids of heme	CZC
Available structure	PDB

PDB ID: 7y7a , Chain SS
Residue indices (Uniprot), coverage	4-137 (1-162), 1.00
auth_asym_id	VE
label_asym_ids of heme	GQD
Available structure	PDB

PDB ID: 7y7a , Chain TLB
Residue indices (Uniprot), coverage	4-137 (1-162), 1.00
auth_asym_id	vm
label_asym_ids of heme	BVH
Available structure	PDB

PDB ID: 7y7a , Chain UDA
Residue indices (Uniprot), coverage	4-137 (1-162), 1.00
auth_asym_id	VO
label_asym_ids of heme	ORE
Available structure	PDB

PDB ID: 7y7a , Chain VKB
Residue indices (Uniprot), coverage	4-137 (1-162), 1.00
auth_asym_id	Vm
label_asym_ids of heme	YRH
Available structure	PDB