Danish

Uniprot ID: W0S1X0

Protein: Cytochrome b559 subunit beta
Organism: Red alga (Porphyridium purpureum)
Length: 44
Sequence:

MTRGNPNQSVTYPIFTFRWLAIHGIAVPTVFFLGAITSMQFIQR

Number of chains: 14

PDB ID: 7y5e , Chain EJ
Residue indices (Uniprot), coverage	5-45 (1-44), 1.00
auth_asym_id	FL
label_asym_ids of heme	YGB
Available structure	PDB

PDB ID: 7y5e , Chain SW
Residue indices (Uniprot), coverage	5-45 (1-44), 1.00
auth_asym_id	f6
label_asym_ids of heme	None
Available structure	PDB

PDB ID: 7y5e , Chain TV
Residue indices (Uniprot), coverage	5-45 (1-44), 1.00
auth_asym_id	F6
label_asym_ids of heme	QRC
Available structure	PDB

PDB ID: 7y5e , Chain ZEA
Residue indices (Uniprot), coverage	5-45 (1-44), 1.00
auth_asym_id	fL
label_asym_ids of heme	DQD
Available structure	PDB

PDB ID: 7y7a , Chain CL
Residue indices (Uniprot), coverage	5-45 (1-44), 1.00
auth_asym_id	f9
label_asym_ids of heme	UBD
Available structure	PDB

PDB ID: 7y7a , Chain CT
Residue indices (Uniprot), coverage	5-45 (1-44), 1.00
auth_asym_id	fE
label_asym_ids of heme	VSD
Available structure	PDB

PDB ID: 7y7a , Chain DK
Residue indices (Uniprot), coverage	5-45 (1-44), 1.00
auth_asym_id	F9
label_asym_ids of heme	SYC
Available structure	PDB

PDB ID: 7y7a , Chain DS
Residue indices (Uniprot), coverage	5-45 (1-44), 1.00
auth_asym_id	FE
label_asym_ids of heme	XPD
Available structure	PDB

PDB ID: 7y7a , Chain EEA
Residue indices (Uniprot), coverage	5-45 (1-44), 1.00
auth_asym_id	fO
label_asym_ids of heme	None
Available structure	PDB

PDB ID: 7y7a , Chain FDA
Residue indices (Uniprot), coverage	5-45 (1-44), 1.00
auth_asym_id	FO
label_asym_ids of heme	XQE
Available structure	PDB

PDB ID: 7y7a , Chain FLB
Residue indices (Uniprot), coverage	5-45 (1-44), 1.00
auth_asym_id	fm
label_asym_ids of heme	QUH
Available structure	PDB

PDB ID: 7y7a , Chain GKB
Residue indices (Uniprot), coverage	5-45 (1-44), 1.00
auth_asym_id	Fm
label_asym_ids of heme	ORH
Available structure	PDB

PDB ID: 7y7a , Chain NTA
Residue indices (Uniprot), coverage	5-45 (1-44), 1.00
auth_asym_id	fZ
label_asym_ids of heme	None
Available structure	PDB

PDB ID: 7y7a , Chain OSA
Residue indices (Uniprot), coverage	5-45 (1-44), 1.00
auth_asym_id	FZ
label_asym_ids of heme	JCG
Available structure	PDB