Danish
Uniprot ID:  G1N9H8
  • Protein: Hemoglobin subunit alpha-A
  • Organism: Wild turkey (Meleagris gallopavo)
  • Length: 142
  • Sequence:
    • MVLSAADKNNVKGIFTKIAGHAEEYGAETLERMFITYPPTKTYFPHFDLSHGSAQIKGHGKKVVAALIEAVNHIDDIAGTLSKLSDLHAHKLRVDPVNFKLLGQCFLVVVAIHHPAALTPEVHASLDKFLCAVGTVLTAKYR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_000012rm , Chain A 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 1-138 (2-139), 0.97
Mutations (UniProt numbering) None
Insertions None
Deletions M1, K140-R142
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_000012rm , Chain A-1 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 1-138 (2-139), 0.97
Mutations (UniProt numbering) None
Insertions None
Deletions M1, K140-R142
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C-1
Available structure PDB
PDB ID:  pdb_000012rh , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-138 (2-139), 0.97
Mutations (UniProt numbering) None
Insertions None
Deletions M1, K140-R142
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_000012rh , Chain C 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-138 (2-139), 0.97
Mutations (UniProt numbering) None
Insertions None
Deletions M1, K140-R142
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme J
Available structure PDB