Danish
Uniprot ID:  O79876
  • Protein: Cytochrome c oxidase subunit 1
  • Organism: Pig (Sus scrofa)
  • Length: 514
  • Sequence:
    • MFVNRWLYSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNQAWAKIHFVIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTAWNTISSMGSFISLTAVMLMIFIIWEAFASKREVSAVELTSTNLEWLHGCPPPYHTFEEPTYINLK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  17
PDB ID:  pdb_00008ugh , Chain PB 
Residue indices (Uniprot), coverage 1-514 (1-514), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id 4A
Missing residues 1MET-1MET
Nonstandard amino acids FME Structure of FMEFME
label_asym_ids of heme TJ ,  UJ
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008ugi , Chain PB 
Residue indices (Uniprot), coverage 2-514 (1-514), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id 4A
label_asym_ids of heme IF ,  JF
Available structure PDB
PDB ID:  pdb_00008ugj , Chain DC 
Residue indices (Uniprot), coverage 1-514 (1-514), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id 8A
Missing residues 1MET-1MET
Nonstandard amino acids FME Structure of FMEFME
label_asym_ids of heme HH ,  IH
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008ugj , Chain PB 
Residue indices (Uniprot), coverage 1-514 (1-514), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id 4A
Missing residues 1MET-1MET
Nonstandard amino acids FME Structure of FMEFME
label_asym_ids of heme EG ,  FG
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00008ugl , Chain A 
Residue indices (Uniprot), coverage 2-514 (1-514), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id 4A
label_asym_ids of heme S ,  R
Available structure PDB
PDB ID:  pdb_00008ugn , Chain PB 
Residue indices (Uniprot), coverage 1-514 (1-514), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id 4A
Missing residues 1MET-1MET
Nonstandard amino acids FME Structure of FMEFME
label_asym_ids of heme WH ,  VH
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008ugn , Chain WD 
Residue indices (Uniprot), coverage 1-514 (1-514), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id 8A
Missing residues 1MET-1MET
Nonstandard amino acids FME Structure of FMEFME
label_asym_ids of heme EL ,  DL
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008ugr , Chain PB 
Residue indices (Uniprot), coverage 2-514 (1-514), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id 4A
label_asym_ids of heme QH ,  RH
Available structure PDB
PDB ID:  pdb_00008ugr , Chain SE 
Residue indices (Uniprot), coverage 2-514 (1-514), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id 8A
label_asym_ids of heme VK ,  WK
Available structure PDB
PDB ID:  pdb_00008zo8 , Chain JA 
Residue indices (Uniprot), coverage 1-514 (1-514), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C1
label_asym_ids of heme XC ,  YC
Available structure PDB
PDB ID:  pdb_00008zou , Chain JA 
Residue indices (Uniprot), coverage 1-514 (1-514), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C1
label_asym_ids of heme LD ,  MD
Available structure PDB
PDB ID:  pdb_00008zp8 , Chain JA 
Residue indices (Uniprot), coverage 1-514 (1-514), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C1
label_asym_ids of heme DD ,  ED
Available structure PDB
PDB ID:  pdb_00008zsn , Chain JA 
Residue indices (Uniprot), coverage 1-514 (1-514), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C1
label_asym_ids of heme WC ,  XC
Available structure PDB
PDB ID:  pdb_00008zso , Chain JA 
Residue indices (Uniprot), coverage 1-514 (1-514), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C1
label_asym_ids of heme TC ,  UC
Available structure PDB
PDB ID:  pdb_00008zsq , Chain JA 
Residue indices (Uniprot), coverage 1-514 (1-514), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C1
label_asym_ids of heme XC ,  YC
Available structure PDB
PDB ID:  pdb_00009buh , Chain T 
Residue indices (Uniprot), coverage 1-513 (1-514), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id Ak
label_asym_ids of heme DC ,  CC
Available structure PDB
PDB ID:  pdb_00009ce2 , Chain OB 
Residue indices (Uniprot), coverage 1-513 (1-514), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id Ak
label_asym_ids of heme SC ,  RC
Available structure PDB