Danish
Uniprot ID:  P24964
  • Protein: Cytochrome b
  • Organism: Pig (Sus scrofa)
  • Length: 379
  • Sequence:
    • MTNIRKSHPLMKIINNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFSSVTHICRDVNYGWVIRYLHANGASMFFICLFIHVGRGLYYGSYMFLETWNIGVVLLFTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVEWIWGGFSVDKATLTRFFAFHFILPFIITALAAVHLLFLHETGSNNPTGISSDMDKIPFHPYYTIKDILGALFMMLILLILVLFSPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALVASILILILMPMLHTSKQRGMMFRPLSQCLFWMLVADLITLTWIGGQPVEHPFIIIGQLASILYFLIILVLMPITSIIENNLLKW
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  28
PDB ID:  pdb_00008iog , Chain A 
Residue indices (Uniprot), coverage 2-379 (1-379), 1.00
Difference from Uniprot sequence variant
Mutations (UniProt numbering) G314S
Insertions None
Deletions None
Sequence identity to UniProt 0.9974
auth_asym_id A
label_asym_ids of heme X ,  W
Available structure PDB
PDB ID:  pdb_00008iog , Chain L 
Residue indices (Uniprot), coverage 2-379 (1-379), 1.00
Mutations (UniProt numbering) G314S
Insertions None
Deletions None
Sequence identity to UniProt 0.9974
auth_asym_id a
label_asym_ids of heme EA ,  DA
Available structure PDB
PDB ID:  pdb_00008ugh , Chain FB 
Residue indices (Uniprot), coverage 1-379 (1-379), 1.00
Mutations (UniProt numbering) G314S
Insertions None
Deletions None
Sequence identity to UniProt 0.9974
auth_asym_id 3P
label_asym_ids of heme UH ,  VH
Available structure PDB
PDB ID:  pdb_00008ugh , Chain VA 
Residue indices (Uniprot), coverage 1-379 (1-379), 1.00
Mutations (UniProt numbering) G314S
Insertions None
Deletions None
Sequence identity to UniProt 0.9974
auth_asym_id 3C
label_asym_ids of heme BG ,  CG
Available structure PDB
PDB ID:  pdb_00008ugi , Chain FB 
Residue indices (Uniprot), coverage 1-379 (1-379), 1.00
Mutations (UniProt numbering) G314S
Insertions None
Deletions None
Sequence identity to UniProt 0.9974
auth_asym_id 3P
label_asym_ids of heme UE ,  VE
Available structure PDB
PDB ID:  pdb_00008ugi , Chain VA 
Residue indices (Uniprot), coverage 1-379 (1-379), 1.00
Mutations (UniProt numbering) G314S
Insertions None
Deletions None
Sequence identity to UniProt 0.9974
auth_asym_id 3C
label_asym_ids of heme GE ,  HE
Available structure PDB
PDB ID:  pdb_00008ugj , Chain FB 
Residue indices (Uniprot), coverage 1-379 (1-379), 1.00
Mutations (UniProt numbering) G314S
Insertions None
Deletions None
Sequence identity to UniProt 0.9974
auth_asym_id 3P
label_asym_ids of heme QF ,  RF
Available structure PDB
PDB ID:  pdb_00008ugj , Chain VA 
Residue indices (Uniprot), coverage 1-379 (1-379), 1.00
Mutations (UniProt numbering) G314S
Insertions None
Deletions None
Sequence identity to UniProt 0.9974
auth_asym_id 3C
label_asym_ids of heme CF ,  DF
Available structure PDB
PDB ID:  pdb_00008ugn , Chain FB 
Residue indices (Uniprot), coverage 1-379 (1-379), 1.00
Mutations (UniProt numbering) G314S
Insertions None
Deletions None
Sequence identity to UniProt 0.9974
auth_asym_id 3P
label_asym_ids of heme IH ,  HH
Available structure PDB
PDB ID:  pdb_00008ugn , Chain VA 
Residue indices (Uniprot), coverage 1-379 (1-379), 1.00
Mutations (UniProt numbering) G314S
Insertions None
Deletions None
Sequence identity to UniProt 0.9974
auth_asym_id 3C
label_asym_ids of heme UG ,  TG
Available structure PDB
PDB ID:  pdb_00008ugr , Chain FB 
Residue indices (Uniprot), coverage 1-379 (1-379), 1.00
Mutations (UniProt numbering) G314S
Insertions None
Deletions None
Sequence identity to UniProt 0.9974
auth_asym_id 3P
label_asym_ids of heme IH ,  JH
Available structure PDB
PDB ID:  pdb_00008ugr , Chain IE 
Residue indices (Uniprot), coverage 1-379 (1-379), 1.00
Mutations (UniProt numbering) G314S
Insertions None
Deletions None
Sequence identity to UniProt 0.9974
auth_asym_id 6P
label_asym_ids of heme NK ,  OK
Available structure PDB
PDB ID:  pdb_00008ugr , Chain VA 
Residue indices (Uniprot), coverage 1-379 (1-379), 1.00
Mutations (UniProt numbering) G314S
Insertions None
Deletions None
Sequence identity to UniProt 0.9974
auth_asym_id 3C
label_asym_ids of heme EH ,  FH
Available structure PDB
PDB ID:  pdb_00008ugr , Chain YD 
Residue indices (Uniprot), coverage 1-379 (1-379), 1.00
Mutations (UniProt numbering) G314S
Insertions None
Deletions None
Sequence identity to UniProt 0.9974
auth_asym_id 6C
label_asym_ids of heme JK ,  KK
Available structure PDB
PDB ID:  pdb_00008zo8 , Chain IB 
Residue indices (Uniprot), coverage 1-379 (1-379), 1.00
Mutations (UniProt numbering) G314S
Insertions None
Deletions None
Sequence identity to UniProt 0.9974
auth_asym_id Qc
label_asym_ids of heme VE ,  WE
Available structure PDB
PDB ID:  pdb_00008zo8 , Chain XA 
Residue indices (Uniprot), coverage 1-379 (1-379), 1.00
Mutations (UniProt numbering) G314S
Insertions None
Deletions None
Sequence identity to UniProt 0.9974
auth_asym_id QC
label_asym_ids of heme CE ,  DE
Available structure PDB
PDB ID:  pdb_00008zou , Chain IB 
Residue indices (Uniprot), coverage 1-379 (1-379), 1.00
Mutations (UniProt numbering) G314S
Insertions None
Deletions None
Sequence identity to UniProt 0.9974
auth_asym_id Qc
label_asym_ids of heme TF ,  UF
Available structure PDB
PDB ID:  pdb_00008zou , Chain XA 
Residue indices (Uniprot), coverage 1-379 (1-379), 1.00
Mutations (UniProt numbering) G314S
Insertions None
Deletions None
Sequence identity to UniProt 0.9974
auth_asym_id QC
label_asym_ids of heme WE ,  XE
Available structure PDB
PDB ID:  pdb_00008zp8 , Chain IB 
Residue indices (Uniprot), coverage 1-379 (1-379), 1.00
Mutations (UniProt numbering) G314S
Insertions None
Deletions None
Sequence identity to UniProt 0.9974
auth_asym_id Qc
label_asym_ids of heme GF ,  HF
Available structure PDB
PDB ID:  pdb_00008zp8 , Chain XA 
Residue indices (Uniprot), coverage 1-379 (1-379), 1.00
Mutations (UniProt numbering) G314S
Insertions None
Deletions None
Sequence identity to UniProt 0.9974
auth_asym_id QC
label_asym_ids of heme OE ,  PE
Available structure PDB
PDB ID:  pdb_00008zso , Chain IB 
Residue indices (Uniprot), coverage 1-379 (1-379), 1.00
Mutations (UniProt numbering) G314S
Insertions None
Deletions None
Sequence identity to UniProt 0.9974
auth_asym_id Qc
label_asym_ids of heme ME ,  NE
Available structure PDB
PDB ID:  pdb_00008zso , Chain XA 
Residue indices (Uniprot), coverage 1-379 (1-379), 1.00
Mutations (UniProt numbering) G314S
Insertions None
Deletions None
Sequence identity to UniProt 0.9974
auth_asym_id QC
label_asym_ids of heme WD ,  XD
Available structure PDB
PDB ID:  pdb_00008zsq , Chain IB 
Residue indices (Uniprot), coverage 1-379 (1-379), 1.00
Mutations (UniProt numbering) G314S
Insertions None
Deletions None
Sequence identity to UniProt 0.9974
auth_asym_id Qc
label_asym_ids of heme BF ,  CF
Available structure PDB
PDB ID:  pdb_00008zsq , Chain XA 
Residue indices (Uniprot), coverage 1-379 (1-379), 1.00
Mutations (UniProt numbering) G314S
Insertions None
Deletions None
Sequence identity to UniProt 0.9974
auth_asym_id QC
label_asym_ids of heme LE ,  ME
Available structure PDB
PDB ID:  pdb_00009buh , Chain IA 
Residue indices (Uniprot), coverage 1-379 (1-379), 1.00
Mutations (UniProt numbering) G314S
Insertions None
Deletions None
Sequence identity to UniProt 0.9974
auth_asym_id 7
label_asym_ids of heme HC ,  GC
Available structure PDB
PDB ID:  pdb_00009buh , Chain UB 
Residue indices (Uniprot), coverage 1-379 (1-379), 1.00
Mutations (UniProt numbering) G314S
Insertions None
Deletions None
Sequence identity to UniProt 0.9974
auth_asym_id w
label_asym_ids of heme VC ,  UC
Available structure PDB
PDB ID:  pdb_00009bxv , Chain CB 
Residue indices (Uniprot), coverage 1-379 (1-379), 1.00
Mutations (UniProt numbering) G314S
Insertions None
Deletions None
Sequence identity to UniProt 0.9974
auth_asym_id w
label_asym_ids of heme DC ,  CC
Available structure PDB
PDB ID:  pdb_00009bxv , Chain G 
Residue indices (Uniprot), coverage 1-379 (1-379), 1.00
Mutations (UniProt numbering) G314S
Insertions None
Deletions None
Sequence identity to UniProt 0.9974
auth_asym_id 7
label_asym_ids of heme SB ,  RB
Available structure PDB